Recombinant S. plicatus Endo-β-N-Acetylglucosaminidase H/Endo H

Instruction Manual!

Product name:	Recombinant S. plicatus Endo-β-N-Acetylglucosaminidase H/Endo H
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 5mM PB, 500mM NaCl, pH 7.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant S.plicatus Endo H is produced by our E.coli expression system and the target gene encoding Pro42-Pro313 is expressed with a 6His tag at the C-terminus.
Names	Endo-Beta-N-Acetylglucosaminidase H, DI-N-Acetylchitobiosyl Beta-N-Acetylglucosaminidase H, Endoglycosidase H, Endo H, Mannosyl-Glycoprotein Endo-Beta-N-Acetyl-Glucosaminidase H
Accession #	P04067
Formulation	Supplied as a 0.2 μm filtered solution of 5mM PB, 500mM NaCl, pH 7.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MAPAPVKQGPTSVAYVEVNNNSMLNVGKYTLADGGGNAFDVAVIFAANINYDTGTKTAYLHFNEN VQRVLDNAVTQIRPLQQQGIKVLLSVLGNHQGAGFANFPSQQAASAFAKQLSDAVAKYGLDGVDF DDEYAEYGNNGTAQPNDSSFVHLVTALRANMPDKIISLYNIGPAASRLSYGGVDVSDKFDYAWNP YYGTWQVPGIALPKAQLSPAAVEIGRTSRSTVADLARRTVDEGYGVYLTYNLDGGDRTADVSAFT RELYGSEAVRTPLEHHHHHH
Background	Endoglycosidase H is a recombinant glycosidase which belongs to the glycosyl hydrolase 18 family. It is a highly specific endoglycosidase which cleaves within the chitobiose core of high mannose and some hybrid oligosaccharides from N-linked glycoproteins, but not highly processed complex oligosaccharides from glycoproteins. It is used for research purposes to deglycosylate glycoproteins