Recombinant Human Grancalcin/GCA

Instruction Manual!

Product name:	Recombinant Human Grancalcin/GCA
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 500mM Nacl, pH 8.5 .
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Grancalcin is produced by our E.coli expression system and the target gene encoding Met1-Ile217 is expressed with a GST tag at the N-terminus.
Names	Grancalcin, GCA, GCL
Accession #	P28676
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 500mM Nacl, pH 8.5 .
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSPILGYWKIKGLVQPTRLLLEYLEEKYEEHLYERDEGDKWRNKKFELGLEFPNLPYYIDGDVKL TQSMAIIRYIADKHNMLGGCPKERAEISMLEGAVLDIRYGVSRIAYSKDFETLKVDFLSKLPEML KMFEDRLCHKTYLNGDHVTHPDFMLYDALDVVLYMDPMCLDAFPKLVCFKKRIEAIPQIDKYLKS SKYIAWPLQGWQATFGGGDHPPKSDLVPRGSMAYPGYGGGFGNFSIQVPGMQMGQPVPETGPAIL LDGYSGPAYSDTYSSAGDSVYTYFSAVAGQDGEVDAEELQRCLTQSGINGTYSPFSLETCRIMIA MLDRDHTGKMGFNAFKELWAALNAWKENFMTVDQDGSGTVEHHELRQAIGLMGYRLSPQTLTTIV KRYSKNGRIFFDDYVACCVKLRALTDFFRKRDHLQQGSANFIYDDFLQGTMAI
Background	Grancalcin (GCA) is a member of the penta EF hand subfamily which includes sorcin, calpain and ALG2. Grancalcin is highly expressed bone marrow and also can detected in neutrophils and macrophages. Grancalcin interacts with L-plastin which known to have actin bundling activity. It indicates that Grancalcin may play an important role in the adhesion of neutrophils to fibronectin. Furthermore, Grancalcin localization is dependent upon calcium and magnesium. It associates with both the granule and membrane fractions, which suggested a role for grancalcin in granule-membrane fusion and degranulation.