Recombinant Human β-Defensin 4/DEFB4

Instruction Manual!

Product name:	Recombinant Human β-Defensin 4/DEFB4
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human beta-Defensin 4 is produced by our E.coli expression system and the target gene encoding Glu23-Pro72 is expressed.
Names	Beta-Defensin 104, Beta-Defensin 4, BD-4, DEFB-4, hBD-4, Defensin Beta 104, DEFB104A, DEFB104, DEFB4, DEFB104B
Accession #	Q8WTQ1
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 130mM NaCl, pH 7.4.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	EFELDRICGYGTARCRKKCRSQEYRIGRCPNTYACCLRKWDESLLNRTKP
Background	Defensins are cationic peptides. It is an important ingredient of the innate immune system. β-defensins are expressed on some leukocytes and epithelial surfaces. Four human β-Defensins have been identified to date: BD-1, BD-2, BD-3 and BD-4. β-defensins contain a six-cysteine motif, they forms three intra-molecular disulfide bonds. β-defensins are also chemoattractant towards immature dendritic cells and memory T cells. The β-defensin proteins are expressed as the C-terminal portion of precursors; they are released by proteolytic cleavage of a signal sequence.