Recombinant Human Flap Endonuclease 1/FEN-1

Instruction Manual!

Product name:	Recombinant Human Flap Endonuclease 1/FEN-1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 50 mM Tris, 50mM NaCl, 1mM DDT, 10% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Flap Endonuclease 1 is produced by our E.coli expression system and the target gene encoding Met1-Lys380 is expressed.
Names	Flap Endonuclease 1, FEN-1, DNase IV, Flap Structure-Specific Endonuclease 1, Maturation Factor 1, MF1, hFEN-1, FEN1, RAD2
Accession #	P39748
Formulation	Supplied as a 0.2 μm filtered solution of 50 mM Tris, 50mM NaCl, 1mM DDT, 10% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MGIQGLAKLIADVAPSAIRENDIKSYFGRKVAIDASMSIYQFLIAVRQGGDVLQNEEGETTSHLM GMFYRTIRMMENGIKPVYVFDGKPPQLKSGELAKRSERRAEAEKQLQQAQAAGAEQEVEKFTKRL VKVTKQHNDECKHLLSLMGIPYLDAPSEAEASCAALVKAGKVYAAATEDMDCLTFGSPVLMRHLT ASEAKKLPIQEFHLSRILQELGLNQEQFVDLCILLGSDYCESIRGIGPKRAVDLIQKHKSIEEIV RRLDPNKYPVPENWLHKEAHQLFLEPEVLDPESVELKWSEPNEEELIKFMCGEKQFSEERIRSGV KRLSKSRQGSTQGRLDDFFKVTGSLSSAKRKEPEPKGSTKKKAKTGAAGKFKRGK
Background	Flap Endonuclease 1 (FEN1) is a member of the XPG/RAD2 endonuclease family. During DNA replication, FEN1 cleaves the 5'-overhanging flap structure and processes the 5' ends of Okazaki fragments for synthesis. FEN1 also exhibits RNase H activity by possessing 5'-3' exonuclease activity on gapped double-stranded or nicked DNA, FEN1 is involved in the long patch base excision repair (LP-BER) pathway, it can cleave within the apurinic/apyrimidinic (AP) site-terminated flap. FEN1 can prevent flaps from equilibrating into structures that lead to duplications and deletions. FEN1 is also involved in replication and repair of rDNA and in repairing mitochondrial DNA.