Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1

Instruction Manual!

Product name:	Recombinant Human C-X-C Motif Chemokine 12/CXCL12/SDF-1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 400mM NaCl, pH 8.5.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human C-X-C Motif Chemokine 12 is produced by our E.coli expression system and the target gene encoding Met19-Met93 is expressed.
Names	Stromal Cell-Derived Factor 1, SDF-1, hSDF-1, C-X-C Motif Chemokine 12, Intercrine Reduced in Hepatomas, IRH, hIRH, Pre-B Cell Growth-Stimulating Factor, PBSF, CXCL12, SDF1, SDF1A, SDF1B
Accession #	P48061
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 400mM NaCl, pH 8.5.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEY LEKALNKRFKM
Background	Stromal Cell-Derived Factor-1 (SDF-1) is a chemokine member of the intercrine family. SDF1 is expressed as five isoforms that differ only in the C terminal tail. SDF1α and SDF1β are identical except for the four residues present in the C-terminus of SDF1β but absent from SDF1α. SDF1 isoforms interact with CXCR4 and CXCR7 receptors on the cell surface, and can also bind syndecan4. SDF1 is known to influence lymphopoiesis, regulate patterning and cell number of neural progenitors, and promote angiogenesis. It also enhances the survival of myeloid progenitor cells.