Recombinant Human Cystatin A

Instruction Manual!

Product name:	Recombinant Human Cystatin A
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human Cystatin A is produced by our E.coli expression system and the target gene encoding Ile2-Phe98 is expressed with a 6His tag at the N-terminus.
Names	Cystatin-A, Cystatin-AS, Stefin-A, CSTA, STF1, STFA
Accession #	P01040
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, pH 8.0.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MHHHHHHIPGGLSEAKPATPEIQEIVDKVKPQLEEKTNETYGKLEAVQYKTQVVAGTNYYIKVRA GDNKYMHLKVFKSLPGQNEDLVLTGYQVDKNKDDELTGF
Background	Human Cystatin A (CSTA) is a member of family 1 of the cystatin superfamily, which is characterized by lacking of disulphide bonds an carbohydrates. Cystatin A is an intracellular inhibitor regulating the activities of cysteine proteases of the papain family such as Cathepsins B, H and L. Cystatin A is also implicated in a number of disease states. Due to altered proteolytic state in cancer progression, Cystatin A may play a role in the proteolytic pathways.