Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP

Instruction Manual!

Product name:	Recombinant E. coli Methionine Aminopeptidase/MetAP/MAP
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant E.coli Methionine Aminopeptidase is produced by our E.coli expression system and the target gene encoding Ala2-Glu264 is expressed with a 6His tag at the C-terminus.
Names	Methionine Aminopeptidase, MAP, Peptidase M, map
Accession #	P0AE18
Formulation	Supplied as a 0.2 μm filtered solution of 20mM TrisHCl, 100mM NaCl, 50% Glycerol, pH 8.0.
Shipping	The product is shipped on dry ice/ice packs.
Storage	Store at < -20°C, stable for 6 months after receipt. Please minimize freeze-thaw cycles.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	AISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACLGYHGYP KSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTIMGERLCRITQE SLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEEPQVLHYDSRETNVVLK PGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVVTDNGCEILTLRKDDTIPAIIS HDELEHHHHHH
Background	Methionine Aminopeptidase (MAP) is a member of the peptidase M24A family. MAP is essential for cell growth because it plays a central role for protein maturation as it removes the initiator Met residue from newly synthesized proteins.