Recombinant Human C-C Motif Chemokine 1/CCL1

Instruction Manual!

Product name:	Recombinant Human C-C Motif Chemokine 1/CCL1
Source:	E.coli
Purity:	Greater than 95% as determined by reducing SDS-PAGE.
Buffer Formulation:	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Applications:	Applications:SDS-PAGE; WB; ELISA; IP.
Storage:	Avoid repeated freeze/thaw cycles. Store at 2-8 oC for one month. Aliquot and store at -80 oC for 12 months.
UOM:	100ug/50ug/200ug/1mg/1g

Source	E.coli
Description	Recombinant Human C-C Motif Chemokine 1 is produced by our E.coli expression system and the target gene encoding Lys24-Lys96 is expressed.
Names	C-C Motif Chemokine 1, Small-Inducible Cytokine A1, T Lymphocyte-Secreted Protein I-309, CCL1, SCYA1
Accession #	P22362
Formulation	Lyophilized from a 0.2 μm filtered solution of 20mM PB, 150mM NaCl, pH 7.2.
Shipping	The product is shipped at ambient temperature.
Reconstitution	Always centrifuge tubes before opening. Do not mix by vortex or pipetting. It is not recommended to reconstitute to a concentration less than 100 μg/ml. Dissolve the lyophilized protein in ddH2O. Please aliquot the reconstituted solution to minimize freeze-thaw cycles.
Storage	Lyophilized protein should be stored at < -20°C, though stable at room temperature for 3 weeks. Reconstituted protein solution can be stored at 4-7°C for 2-7 days. Aliquots of reconstituted samples are stable at < -20°C for 3 months.
Purity	Greater than 95% as determined by reducing SDS-PAGE.
Endotoxin	Less than 0.1 ng/µg (1 IEU/µg) as determined by LAL test.
Amino Acid Sequence	MKSMQVPFSRCCFSFAEQEIPLRAILCYRNTSSICSNEGLIFKLKRGKEACALDTVGWVQRHRKM LRHCPSKRK
Background	Chemokine (C-C Motif) Ligand 1 (CCL1) is a small glycoprotein secreted by activated T cells, which play a central role during immunoregulatory and inflammaion processes. Human CCL1 has been assumed to be a homologue of the mouse TCA3. While the two proteins share only approximately 42% amino acid sequence identity, both chemokines contain an extra pair of cysteine residues not found in most other chemokines. CCL1 attracts monocytes, NK cells, and immature B cells and dendritic cells by interacting with cell surface chemokine receptor CCR8. CCL1 is identified as a potent inhibitor of HIV-1 envelope-mediated cell-cell fusion and virus infection.